General Information

  • ID:  hor006227
  • Uniprot ID:  P55208
  • Protein name:  CNP-38
  • Gene name:  NA
  • Organism:  Triakis scyllium (Banded houndshark) (Hemigaleus pingi)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  CNP-115 is differentially processed to produce CNP-38 and CNP-39 in the heart and CNP-22 in the brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Triakis (genus), Triakidae (family), Carcharhiniformes (order), Galeoidea (superorder), Galeomorphii , Selachii (infraclass), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  KDLSNNPLRFRGRSKKGPSRGCFGVKLDRIGAMSGLGC
  • Length:  38(99-136)
  • Propeptide:  MSGQTSFYCGLLLVLLIQAQARPRSDDSLQTLSRLLEDEYGHYLPSDELNNEAQEMSPAASLPEFNADQSDLELPWDRESREIGGRPFRQEAVLARLLKDLSNNPLRFRGRSKKGPSRGCFGVKLDRIGAMSGLGC
  • Signal peptide:  MSGQTSFYCGLLLVLLIQAQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone which may be vasoactive and natriuretic. Has a cGMP-stimulating activity (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  22-38
  • Structure ID:  AF-P55208-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006227_AF2.pdbhor006227_ESM.pdb

Physical Information

Mass: 473991 Formula: C173H293N59O49S3
Absent amino acids: EHQTWY Common amino acids: G
pI: 11.6 Basic residues: 9
Polar residues: 15 Hydrophobic residues: 9
Hydrophobicity: -60.79 Boman Index: -9322
Half-Life / Aliphatic Index: 1.3 hour Aliphatic Index: 61.58
Instability Index: 3339.74 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.38

Literature

  • PubMed ID:  1474339
  • Title:  Different molecular forms of C-type natriuretic peptide isolated from the brain and heart of an elasmobranch, Triakis scyllia.